Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

TUBA4A Antibody

SKU: orb334961

Description

Goat polyclonal antibody to alpha tubulin. Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly.

Research Area

Neuroscience

Images & Validation

Tested ApplicationsWB
Dilution RangeWB:1:250-1:2,000
ReactivityBovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
Application Notes
The antibody solution should be gently mixed before use.

Key Properties

HostGoat
ClonalityPolyclonal
IsotypeIgG
ImmunogenAntigen: Purified recombinant peptide derived from within residues 80 aa to the N-terminus of human alpha tubulin produced in E. coli. Antigen Sequence: MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGKHVPRAVFVDLEPTVIDEI
TargetTubulin, alpha 4a
PurificationEpitope affinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Form/AppearancePolyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration1 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

TUBA1, TUBA4A antibody.

Similar Products

  • TUBA1C Rabbit Polyclonal Antibody [orb7128]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Mouse, Porcine, Rabbit

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • TUBA4A Antibody [orb46227]

    ELISA,  IF,  IHC,  IP,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • Mouse Tubulin Alpha 4A (TUBa4A) ELISA Kit [orb780652]

    Mouse

    0.32-20 ng/mL

    0.127 ng/mL

    48 T, 96 T
  • TUBA4A Rabbit Polyclonal Antibody [orb577468]

    IHC,  IP,  WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Tubulin, Alpha 4a Rabbit Polyclonal Antibody [orb500742]

    WB

    Bovine, Canine, Equine, Human, Porcine, Rabbit, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

TUBA4A Antibody

Western blot analysis of staining of HeLa lysate using TUBA4A antibody

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

TUBA4A Antibody (orb334961)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
$ 280.00
Choose Conjugation or Carrier Free Version
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 2-3 days
Bulk Enquiry