You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330433 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Rora |
Target | Rora |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Mouse |
Predicted Reactivity | Bovine, Human, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rora |
Protein Sequence | Synthetic peptide located within the following region: MESAPAAPDPAASEPGSSGSEAAAGSRETPLTQDTGRKSEAPGAGRRQSY |
UniProt ID | P51448 |
MW | 59kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti 9530021D13Rik antibody, anti Nr1f1 antibody, Read more... |
Note | For research use only |
NCBI | NP_038674 |
Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/mL.
Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/mL.
Sample Type: Mouse Lung lysates, Antibody Dilution: 1.0 ug/mL.
WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |