RORA Rabbit Polyclonal Antibody

• Catalog Number: orb330434
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RORA
• Target: RORA
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Mouse, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RORA
• Protein Sequence: Synthetic peptide located within the following region: ARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEIIPCKICGDKSSGIHY
• UniProt ID: B6ZGS4
• MW: 59kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti MGC119326 antibody, anti MGC119329 antibody,
• Note: For research use only
• NCBI: NP_599023

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

WB Suggested Anti-RORA Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Lung.