RORA Rabbit Polyclonal Antibody

• Catalog Number: orb330424
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RORA
• Target: RORA
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RORA
• Protein Sequence: Synthetic peptide located within the following region: PGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDI
• UniProt ID: P35398
• MW: 62kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti MGC119326 antibody, anti MGC119329 antibody,
• Note: For research use only
• NCBI: NP_002934

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.

RORA antibody - middle region (orb330424), Catalog Number: orb330424, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Nucleus in Human Pineal Tissue, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

WB Suggested Anti-RORA Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate.