You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329792 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RORA |
Target | RORA |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RORA |
Protein Sequence | Synthetic peptide located within the following region: GFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFK |
UniProt ID | P35398 |
MW | 59 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti MGC119326 antibody, anti MGC119329 antibody, Read more... |
Note | For research use only |
NCBI | NP_599024 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/mL.
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.
WB Suggested Anti-RORA Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: 721_B cell lysate, RORA is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
IHC, WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Human, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |