RORA Rabbit Polyclonal Antibody

• Catalog Number: orb330425
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RORA
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RORA
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 63kDa
• Target: RORA
• UniProt ID: P35398
• Protein Sequence: Synthetic peptide located within the following region: GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP
• NCBI: NP_599022
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti MGC119326 antibody, anti MGC119329 antibody,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/mL, Peptide Concentration: 2.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Positive control (+): Human liver (LI), Negative control (-): Human stomach (ST), Antibody concentration: 1 ug/mL.

Human kidney

WB Suggested Anti-RORA Antibody Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate.