MAPK1 Rabbit Polyclonal Antibody

• Catalog Number: orb327488
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MK01
• Target: MAPK1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAPK1
• Protein Sequence: Synthetic peptide located within the following region: HKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYD
• UniProt ID: P28482
• MW: 41 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti ERK antibody, anti p38 antibody, anti p40 ant
• Research Area: Apoptotic, Cancer, Epigenetics, Infectious Disease
• Note: For research use only
• NCBI: NP_002736.3
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1.0 ug/mL.

Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.