You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
MAP4K1 Rabbit Polyclonal Antibody
Catalog Number: orb579640
| Catalog Number | orb579640 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to MAP4K1 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat, Zebrafish |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MAP4K1 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 90kDa |
| Target | MAP4K1 |
| UniProt ID | A8MWC4 |
| Protein Sequence | Synthetic peptide located within the following region: VHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATK |
| NCBI | NP_001036065 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | HPK1 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): HepG2 Cell Lysate (HG), Antibody concentration: 1 ug/ml.
WB Suggested Anti-MAP4K1 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate. MAP4K1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
- Item 1 of 4
- Item 1 of 4
- Item 1 of 2
Phospho-MAP4K1 (Ser171) Rabbit Polyclonal Antibody [orb6374]
FC, IF, IHC-Fr, IHC-P
Canine, Equine, Mouse, Porcine
Human, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 200 μl, 100 μl - Item 1 of 2
- Item 1 of 2
