IL12B Rabbit Polyclonal Antibody

• Catalog Number: orb589619
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IL12B
• Target: IL12B
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IL12B
• Protein Sequence: Synthetic peptide located within the following region: IKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSK
• UniProt ID: P29460
• MW: 36 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CLMF, NKSF, CLMF2, IMD28, IMD29, NKSF2, IL-12B
• Research Area: Immunology & Inflammation, Stem Cell & Development
• Note: For research use only
• NCBI: NP_002178.2

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 0.5 ug/ml.

Sample Tissue: Human DLD1 Whole Cell lysates, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/ml.