GFAP Antibody

SKU: orb382936

Description

Goat polyclonal antibody to GFAP. Glial fibrillary acidic protein is a major intermediate filament protein of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development.

Research Area

Neuroscience

Images & Validation

• Tested Applications: WB
• Dilution Range: WB:1:500-1:5,000
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Recombinant peptide derived from within residues 375 aa to the C-terminus of human GFAP produced in E. coli. Antigen Sequence: ENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM
• Target: Glial fibrillary acidic protein
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

ALXDRD, glial fibrillary acidic protein antibody.

Quick Database Links

Gene Symbol

Glial fibrillary acidic protein