beta-Catenin Antibody

SKU: orb153335

Description

Goat polyclonal antibody to Catenin (cadherin-associated protein), beta 1. Beta Catenin is a 88 kDa protein and is a key downstream effector in the Wnt signalling pathway. It is involved in early embryonic development and tumorigenesis. Beta Catenin is part of a complex of proteins that constitute adherens junctions, necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. This protein anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete.

Images & Validation

• Tested Applications: IF, IHC-P, WB
• Dilution Range: WB:1:500-1:2,000, IF:1:50-1:250, IHC-P:1:250-1:1,000
• Reactivity: Canine, Human, Monkey, Mouse, Rat
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 731 aa to the C-terminus of human beta Catenin produced in E. coli. Antigen Sequence: MDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
• Target: Catenin (cadherin-associated protein), beta 1, 88kDa
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: Please inquire
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

cadherin-associated protein, CTNNB, CTNNB1, MRD19, armadillo antibody.

beta-Catenin Antibody at 1/1,000 dilution, lysate at 100 µg per lane; Rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution.

Confocal immunofluoroscence - beta-Catenin Antibody in BEAS-2B cells at 1/250 dilution, cells were fixed with 4% of PFA.

IHC of mouse intestine using beta-Catenin Antibody and FFPE tissue after heat-induced antigen retrieval. beta-Catenin Antibody at 1:500/DAB detection.

IHC of mouse liver using beta-Catenin Antibody and FFPE tissue after heat-induced antigen retrieval. beta-Catenin Antibody at 1:500/DAB detection.

IHC of mouse brain using beta-Catenin Antibody and FFPE tissue after heat-induced antigen retrieval. beta-Catenin Antibody at 1:500/DAB detection.

IHC of mouse lung using beta-Catenin Antibody and FFPE tissue after heat-induced antigen retrieval. beta-Catenin Antibody at 1:500/DAB detection.

IHC of mouse retina using beta-Catenin Antibody and FFPE tissue after heat-induced antigen retrieval. beta-Catenin Antibody at 1:500/DAB detection.

Quick Database Links

Gene Symbol

Catenin (cadherin-associated protein), beta 1, 88kDa