Cart summary

You have no items in your shopping cart.

beta-Catenin Antibody

SKU: orb153335

Description

Goat polyclonal antibody to Catenin (cadherin-associated protein), beta 1. Beta Catenin is a 88 kDa protein and is a key downstream effector in the Wnt signalling pathway. It is involved in early embryonic development and tumorigenesis. Beta Catenin is part of a complex of proteins that constitute adherens junctions, necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. This protein anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete.

Images & Validation

Tested ApplicationsIF, IHC-P, WB
Dilution RangeWB:1:500-1:2,000, IF:1:50-1:250, IHC-P:1:250-1:1,000
ReactivityCanine, Human, Monkey, Mouse, Rat
Application Notes
The antibody solution should be gently mixed before use.

Key Properties

HostGoat
ClonalityPolyclonal
IsotypeIgG
ImmunogenAntigen: Purified recombinant peptide derived from within residues 731 aa to the C-terminus of human beta Catenin produced in E. coli. Antigen Sequence: MDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
TargetCatenin (cadherin-associated protein), beta 1, 88kDa
PurificationEpitope affinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Form/AppearancePolyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
ConcentrationPlease inquire
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

cadherin-associated protein, CTNNB, CTNNB1, MRD19, armadillo antibody.

Similar Products

  • Beta-catenin Rabbit Polyclonal Antibody [orb1294385]

    IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 25 μl
  • Beta catenin Rabbit Polyclonal Antibody [orb500798]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep, Zebrafish

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • beta Catenin/CTNNB1 Rabbit Polyclonal Antibody [orb402308]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Beta catenin Rabbit Polyclonal Antibody [orb10246]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep, Zebrafish

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-beta Catenin (Tyr333) Rabbit Polyclonal Antibody [orb155828]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Gallus, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

beta-Catenin Antibody

beta-Catenin Antibody at 1/1,000 dilution, lysate at 100 µg per lane; Rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution.

beta-Catenin Antibody

Confocal immunofluoroscence - beta-Catenin Antibody in BEAS-2B cells at 1/250 dilution, cells were fixed with 4% of PFA.

beta-Catenin Antibody

IHC of mouse intestine using beta-Catenin Antibody and FFPE tissue after heat-induced antigen retrieval. beta-Catenin Antibody at 1:500/DAB detection.

beta-Catenin Antibody

IHC of mouse liver using beta-Catenin Antibody and FFPE tissue after heat-induced antigen retrieval. beta-Catenin Antibody at 1:500/DAB detection.

beta-Catenin Antibody

IHC of mouse brain using beta-Catenin Antibody and FFPE tissue after heat-induced antigen retrieval. beta-Catenin Antibody at 1:500/DAB detection.

beta-Catenin Antibody

IHC of mouse lung using beta-Catenin Antibody and FFPE tissue after heat-induced antigen retrieval. beta-Catenin Antibody at 1:500/DAB detection.

beta-Catenin Antibody

IHC of mouse retina using beta-Catenin Antibody and FFPE tissue after heat-induced antigen retrieval. beta-Catenin Antibody at 1:500/DAB detection.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol
IF
Immunofluorescence
View Protocol

beta-Catenin Antibody (orb153335)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
$ 280.00
Instock
In stock
Bulk Enquiry