Vimentin Antibody

SKU: orb382937

Description

Goat polyclonal antibody to Vimentin. VIM is a member of the intermediate filament family. The cytoskeleton is made by these intermediate filaments, along with actin microfilaments and microtubules. VIM is responsible for integrity of the cytoplasm, stabilization of the cytoskeletal interactions and maintaining cell shape. This protein controls the transport of LDL-derived cholesterol from a lysosome to the site of esterification and is also involved in the immune response. It functions as an organizer of a number of critical proteins involved in migration, attachment and cell signaling.

Research Area

Musculoskeletal & Connective Tissue Research

Images & Validation

• Tested Applications: WB
• Dilution Range: WB:1:500-1:5,000; IF:1:100-1:500
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Recombinant peptide derived from within residues 390 aa to the C-terminus of human VIM produced in E. coli. Antigen Sequence: ALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE
• Target: Vimentin
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 100 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CTRCT30, Epididymis luminal protein 113, FLJ36605, HEL113, VIM antibody.

Quick Database Links

Gene Symbol

Vimentin