Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Vimentin Antibody

SKU: orb382937

Description

Goat polyclonal antibody to Vimentin. VIM is a member of the intermediate filament family. The cytoskeleton is made by these intermediate filaments, along with actin microfilaments and microtubules. VIM is responsible for integrity of the cytoplasm, stabilization of the cytoskeletal interactions and maintaining cell shape. This protein controls the transport of LDL-derived cholesterol from a lysosome to the site of esterification and is also involved in the immune response. It functions as an organizer of a number of critical proteins involved in migration, attachment and cell signaling.

Research Area

Musculoskeletal & Connective Tissue Research

Images & Validation

Tested ApplicationsWB
Dilution RangeWB:1:500-1:5,000; IF:1:100-1:500
ReactivityBovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
Application Notes
The antibody solution should be gently mixed before use.

Key Properties

HostGoat
ClonalityPolyclonal
IsotypeIgG
ImmunogenAntigen: Recombinant peptide derived from within residues 390 aa to the C-terminus of human VIM produced in E. coli. Antigen Sequence: ALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE
TargetVimentin
PurificationEpitope affinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Form/AppearancePolyclonal antibody supplied as a 100 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration1 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CTRCT30, Epididymis luminal protein 113, FLJ36605, HEL113, VIM antibody.

Similar Products

  • Vimentin Rabbit Polyclonal Antibody [orb11559]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  KO/KD Validated,  WB

    Bovine, Gallus, Goat, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Vimentin Mouse Monoclonal Antibody [orb499662]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  KO/KD Validated,  WB

    Mouse, Rat

    Human

    Mouse

    Monoclonal

    Unconjugated

    50 μl, 100 μl, 200 μl, 200 μg
  • Recombinant mouse vimentin Antibody [orb669776]

    ICC,  IHC,  WB

    Human, Mouse

    Mouse

    Monoclonal

    Unconjugated

    0.1 mg
  • Recombinant rabbit vimentin Antibody [orb669777]

    ICC,  IHC,  WB

    Human, Mouse

    Rabbit

    Monoclonal

    Unconjugated

    0.1 mg
  • Vimentin Antibody [orb319707]

    ELISA,  ICC,  IHC,  WB

    Bovine, Canine, Equine, Feline, Goat, Guinea pig, Hamster, Primate, Rabbit, Rodent, Sheep

    Human, Mouse, Rat

    Gallus

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μg
$ 300.00
Choose Conjugation or Carrier Free Version
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 2-3 days
Bulk Enquiry