TUBB Antibody

SKU: orb653857

Description

Goat polyclonal antibody to TUBB. Tubulin beta class I protein forms a dimer with alpha tubulin and acts as a structural component of microtubules. This protein is involved in cortical dysplasia and other, brain malformations.

Images & Validation

• Tested Applications: WB
• Dilution Range: WB:1:500-1:2,000
• Reactivity: Canine, Human, Monkey, Mouse, Rat
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Recombinant peptide derived from within residues 345 aa to the C-terminus of human TUBB var1 produced in E. coli. . Antigen Sequence: MKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEEAEEEA
• Target: Beta tubulin
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 100 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CDCBM6, CSCSC1, M40, OK/SW-cl.56, TUBB1, tubulin beta class I, TUBB5 antibody.

Quick Database Links

Gene Symbol

Beta tubulin