TBX18 Antibody

SKU: orb653864

Description

Goat polyclonal antibody to TBX18. This protein is a member of an evolutionarily conserved family of transcription factors that plays a crucial role in embryonic development. TBX18 acts as a transcriptional repressor by antagonizing transcriptional activators in the T-box family.

Research Area

Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Dilution Range: WB:1:500-1:2,000
• Reactivity: Canine, Human, Monkey, Mouse, Rat
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Recombinant peptide derived from within residues 330 aa to the C-terminus of Tbx18 produced in E. coli. Antigen Sequence: QSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCG
• Target: T-box transcription factor TBX18
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

T-box transcription factor 18 antibody.

Quick Database Links

Gene Symbol

T-box transcription factor TBX18