TBX18 antibody

• Catalog Number: orb576439
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TBX18
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TBX18
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 65 kDa
• Target: TBX18
• UniProt ID: O95935
• Protein Sequence: Synthetic peptide located within the following region: NQTHQGSYNTFRLHSPCALYGYNFSTSPKLAASPEKIVSSQGSFLGSSPS
• NCBI: XP_943361
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CAKUT2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml.

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.

Positive control (+): 293T (2T), Negative control (-): HeLa (HL), Antibody concentration: 0.5 ug/ml.

IHC Information: Paraffin embedded breast tissue, tested with an antibody dilution of 5 ug/ml.

IHC Information: Paraffin embedded renaltubules tissue, tested with an antibody dilution of 5 ug/ml.

WB Suggested Anti-TBX18 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.