TARDBP Rabbit Polyclonal Antibody

• Catalog Number: orb329851
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TARDBP
• Target: TARDBP
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TARDBP
• Protein Sequence: Synthetic peptide located within the following region: GISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLGN
• UniProt ID: Q13148
• MW: 45kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti TDP-43 antibody, anti ALS10 antibody
• Note: For research use only
• NCBI: NP_031401

Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.

Immunohistochemistry with Thymus tissue at an antibody concentration of 5 ug/mL using anti-TARDBP antibody (orb329851).

WB Suggested Anti-TARDBP Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: Human Muscle.