TARDBP Rabbit Polyclonal Antibody

• Catalog Number: orb330029
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TARDBP
• Target: TARDBP
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TARDBP
• Protein Sequence: Synthetic peptide located within the following region: MGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGWG
• UniProt ID: Q13148
• MW: 45kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti ALS10 antibody, anti TDP-43 antibody
• Note: For research use only
• NCBI: NP_031401

Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.25 ug/mL, Peptide Concentration: 1.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Human Heart

Human Liver

Rabbit Anti-TARDBP antibody, Paraffin Embedded Tissue: Human Heart, cell Cellular Data: cardiac cell, Antibody Concentration: 4.0-8.0 ug/mL Magnification: 400X.

WB Suggested Anti-TARDBP Antibody Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate, TARDBP is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.