TARDBP Rabbit Polyclonal Antibody

• Catalog Number: orb329852
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TARDBP
• Target: TARDBP
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TARDBP
• Protein Sequence: Synthetic peptide located within the following region: VYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLK
• UniProt ID: Q13148
• MW: 45kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti TDP-43 antibody, anti ALS10 antibody
• Note: For research use only
• NCBI: NP_031401

Rabbit Anti-TARDBP Antibody, Catalog Number: orb329852, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

WB Suggested Anti-TARDBP Antibody, Positive Control: Lane 1: 5 ug mouse brain cytoplasm Lane 2: 5 ug mouse brain nucleus, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti rabbit - IR-dye, Secondry Antibody Dilution: 1:10000.

WB Suggested Anti-TARDBP Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Liver.