PRKG1 Rabbit Polyclonal Antibody

SKU: orb589732

Description

Rabbit polyclonal antibody to PRKG1

Research Area

Cardiovascular Research, Epigenetics & Chromatin, Neuroscience, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PRKG1
• Target: PRKG1
• Protein Sequence: Synthetic peptide located within the following region: FNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF
• Molecular Weight: 42 kDa
• Purification: Affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

PKG, cGK, AAT8, PKG1, cGK1, cGKI, cGK 1, PRKG1B, PRKGR1B, cGKI-BETA, cGKI-alpha

Sample Tissue: Human 786-0 Whole Cell lysates, Antibody Dilution: 1 ug/ml.

Quick Database Links

Gene Symbol

PRKG1

UniProt

Q13976

RefSeq (Protein):NP_001091982.1