OCLN antibody

• Catalog Number: orb578638
• Category: Antibodies
• Description: OCLN is an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the full nature of these products has not been described.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OCLN
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 59kDa
• Target: OCLN
• UniProt ID: Q16625
• Protein Sequence: Synthetic peptide located within the following region: VRPMLSQPAYSFYPEDEILHFYKWTSPPGVIRILSMLIIVMCIAIFACVA
• NCBI: NP_002529
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: BLCPMG
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of Human Fetal Liver using OCLN antibody.

Western blot analysis of Rat Brain using OCLN antibody.