MAP2K2 Rabbit Polyclonal Antibody

SKU: orb580590

Description

MAP2K2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of MAP2K2. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human MAP2K2. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MAP2K2
• Target: MAP2K2
• Protein Sequence: Synthetic peptide located within the following region: IKNPAERADLKMLTNHTFIKRSEVEEVDFAGWLCKTLRLNQPGTPTRTAV
• Molecular Weight: 44kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CFC4, MEK2, MKK2, MAPKK2, PRKMK2

Quick Database Links

Gene Symbol

MAP2K2

UniProt

P36507

RefSeq (Protein):NP_109587