LEF1 Rabbit Polyclonal Antibody

• Catalog Number: orb574185
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LEF1
• Target: LEF1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LEF1
• Protein Sequence: Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ
• UniProt ID: Q9UJU2
• MW: 44kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: LEF-1, TCF10, TCF7L3, TCF1ALPHA
• Note: For research use only
• NCBI: NP_057353

Positive control (+): Human Ovary (OV), Negative control (-): Human liver (LI), Antibody concentration: 3 ug/ml.

Human Intestine

WB Suggested Anti-LEF1 Antibody Titration: 2.0 ug/ml, Positive Control: Jurkat cell lysate, LEF1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.