LAMC3 Rabbit Polyclonal Antibody

SKU: orb331324

Description

Rabbit polyclonal antibody to LAMC3

Research Area

Cell Biology, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Porcine, Rabbit

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human LAMC3
• Target: LAMC3
• Protein Sequence: Synthetic peptide located within the following region: ERMLGNAAPLSSSAKKKGREAEVLAKDSAKLAKALLRERKQAHRRASRLT
• Molecular Weight: 140kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti RP11-143H20.1 antibody, anti OCCM antibody

WB Suggested Anti-LAMC3 Antibody, Titration: 1.0 ug/ml, Positive Control: Hela Whole Cell, LAMC3 is supported by BioGPS gene expression data to be expressed in HeLa.

Quick Database Links

Gene Symbol

LAMC3

UniProt

Q9Y6N6

RefSeq:BAD92124