KLF4 Rabbit Polyclonal Antibody

• Catalog Number: orb576677
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KLF4
• Target: KLF4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KLF4
• Protein Sequence: Synthetic peptide located within the following region: AGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKH
• UniProt ID: O43474
• MW: 55 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: EZF, GKLF
• Research Area: Cancer Biology, Epigenetics & Chromatin, Molecular
• Note: For research use only
• NCBI: NP_004226

25 ug of the indicated Mouse whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide sequence is contained within isoforms present at 44 kDa and 38 kDa.

Sample Tissue: Mouse Kidney, Antibody Dilution: 1 ug/ml.

Human lung cell line

Human lung epithelial cell

prostate

WB Suggested Anti-KLF4 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human heart.