You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576677 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KLF4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human KLF4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 55 kDa |
Target | KLF4 |
UniProt ID | O43474 |
Protein Sequence | Synthetic peptide located within the following region: AGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKH |
NCBI | NP_004226 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | EZF, GKLF Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Mouse whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide sequence is contained within isoforms present at 44 kDa and 38 kDa.
Sample Tissue: Mouse Kidney, Antibody Dilution: 1 ug/ml.
Human lung cell line
Human lung epithelial cell
prostate
WB Suggested Anti-KLF4 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human heart.
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Equine, Gallus, Guinea pig, Porcine, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-P, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |