KLF4 Rabbit Polyclonal Antibody

SKU: orb576677

Description

Rabbit polyclonal antibody to KLF4

Research Area

Cancer Biology, Epigenetics & Chromatin, Molecular Biology, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KLF4
• Target: KLF4
• Protein Sequence: Synthetic peptide located within the following region: AGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKH
• Molecular Weight: 55 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

EZF, GKLF

25 ug of the indicated Mouse whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide sequence is contained within isoforms present at 44 kDa and 38 kDa.

Sample Tissue: Mouse Kidney, Antibody Dilution: 1 ug/ml.

Human lung cell line

Human lung epithelial cell

prostate

WB Suggested Anti-KLF4 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human heart.

Quick Database Links

Gene Symbol

KLF4

UniProt

O43474

RefSeq (Protein):NP_004226