CD81 Antibody

SKU: orb2705214

Description

CD81 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. This protein is a cell surface glycoprotein, known to complex with integrins and appears to promote muscle cell fusion and support myotube maintenance, acting as platform for receptor clustering and signalling motility

Research Area

Immunology & Inflammation

Images & Validation

• Tested Applications: WB
• Dilution Range: WB:1:1,000-1:2,000
• Reactivity: Canine, Human, Monkey, Mouse, Rat
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 115 aa to 205 aa of human CD81 produced in E. coli. Antigen Sequence: NKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIG
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide.
• Concentration: 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CD81 antigen, CVID6, S5.7, TAPA1, Tetraspanin-28, TSPAN28 antibody