ATG5 antibody

• Catalog Number: orb330734
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ATG5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ATG5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 32kDa
• Target: ATG5
• UniProt ID: Q9H1Y0
• Protein Sequence: Synthetic peptide located within the following region: DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD
• NCBI: NP_004840
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti APG5 antibody, anti APG5L antibody, anti ASP
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Fetal Heart tissue using ATG5 antibody

Western blot analysis of HepG2 cell lysate tissue using ATG5 antibody

Immunohistochemical staining of human Placenta tissue using ATG5 antibody

Immunohistochemical staining of human Prostate tissue using ATG5 antibody

Western blot analysis of human Fetal Lung tissue using ATG5 antibody

Western blot analysis of human Fetal Liver tissue using ATG5 antibody