You have no items in your shopping cart.
Description
Research Area
Neuroscience
Images & Validation
−
Key Properties
−| Source | Protein expressed in Escherichia coli. |
|---|---|
| MW | 14460 Da |
| Purity | 95% by Chromatography and SDS-PAGE |
| Protein Sequence | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVAT VAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQ EGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
Storage & Handling
−| Storage | Room temperature, avoid light exposure. |
|---|---|
| Form/Appearance | Lyophilized 1 mg/vial |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−- Item 1 of 8
Alpha Synuclein A53T Mutant Pre-formed Fibrils [orb1822360]
In vitro, In vivo, SDS-PAGE, WB
>95%
~14.46 kDa
Recombinant
100 μg - Item 1 of 7
Alpha Synuclein Pre-formed Fibrils [orb1822369]
In vitro, In vivo, SDS-PAGE, WB
>95%
~14.46 kDa
Recombinant
100 μg - Item 1 of 5
- Item 1 of 5
Alpha Synuclein Monomers [orb1822364]
In vitro, In vivo, SDS-PAGE, WB
>95%
~14.46 kDa
Recombinant
100 μg Recombinant Human SNCA Protein [orb2994581]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 16.7 KDa. Observed: 18 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days