You have no items in your shopping cart.
Virus L protein
SKU: orb604544
Featured
Description
Research Area
Infectious Disease & Virology
Images & Validation
−Item 1 of 3
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus) |
| Tag | N-terminal 6xHis-tagged |
| Molecular Weight | 24.9 kDa |
| Expression Region | 625-809aa |
| Protein Length | Partial |
| Protein Sequence | RGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQCYMHVSDYYNPPHNLTLENRDNPPEGPSSYRGHMGGIEGLQQKLWTSISCAQISLVEIKTGFKLRSAVMGDNQCITVLSVFPLETDADEQEQSAEDNAARVAASLAKVTSACGIFLKPDETFVHSGFIYFGKKQYLNG |
| Purity | Greater than 85% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Large structural protein Replicase Transcriptase
Similar Products
−- Item 1 of 2
Human TNFSF14 protein [orb705344]
Greater than 85% as determined by SDS-PAGE.
46.7 kDa
Mammalian cell
1 mg, 20 μg, 100 μg 
Recombinant Human LIGHT Protein [orb2994034]
Unconjugated
SDS-PAGE: Greater than 90% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 43.3 KDa. Observed: 45-60 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human LIGHT Protein [orb2994330]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 18.2 KDa. Observed: 18-24 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg- Item 1 of 3
- Item 1 of 3
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus) L.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus) L.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Virus L protein (orb604544)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks