Human TNFSF14 protein

SKU: orb705344

Description

This Human TNFSF14 protein spans the amino acid sequence from region 74-240aa. Purity: Greater than 85% as determined by SDS-PAGE.

Research Area

Immunology & Inflammation

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  Read more...

Key Properties

• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: ①Measured by its binding ability in a functional ELISA. Immobilized TNFRSF14 at 5 μg/ml can bind TNFSF14, the EC50 is 45.44-53.29 ng/ml.
• Tag: N-terminal hFC-Myc-tagged
• Expression Region: 74-240aa
• Protein Length: Partial
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.
• MW: 46.7 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Protein Sequence: DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

(Herpes virus entry mediator ligand)(HVEM-L)(Herpesvirus entry mediator ligand)(CD258)(HVEML)(LIGHT)(UNQ391)(PRO726)

Quick Database Links

UniProt

O43557