UCHL1 Rabbit Polyclonal Antibody

• Catalog Number: orb331010
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PGP9.5
• Target: UCHL1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human UCHL1
• Protein Sequence: Synthetic peptide located within the following region: HLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALC
• UniProt ID: P09936
• MW: 25kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti-Epididymis luminal protein 117 antibody, anti
• Research Area: Cell Biology, Protein Biochemistry
• Note: For research use only
• NCBI: NP_004172

Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. UCHL1 is supported by BioGPS gene expression data to be expressed in 721_B.

WB Suggested Anti-UCHL1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human brain.