UCHL1 Rabbit Polyclonal Antibody

SKU: orb331031

Description

Rabbit polyclonal antibody to PGP9.5

Research Area

Cell Biology, Protein Biochemistry

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human UCHL1
• Target: UCHL1
• Protein Sequence: Synthetic peptide located within the following region: ELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALCKAA
• Molecular Weight: 25kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti-Epididymis luminal protein 117 antibody, anti-HEL 117 antibody, anti-HEL S 53 antibody, anti-NDGOA antibody, anti-Neuron cytoplasmic protein 9.5 antibody, anti-Park 5 antibody, anti-PARK5 antibody, anti-PGP 9.5 antibody, anti-PGP9.5 antibody, anti-PGP95 antibody, anti-Protein gene product 9.5 antibody, anti-Ubiquitin C terminal esterase L1 antibody, anti-Ubiquitin C terminal hydrolase antibody, anti-Ubiquitin C terminal hydrolase L1 antibody, anti-Ubiquitin carboxyl terminal esterase L1 antibody, anti-Ubiquitin thioesterase L1 antibody, anti-Ubiquitin thiolesterase antibody, anti-UCH-L1 antibody, anti-UCHL1 antibody, anti-UCHL 1 antibody

Sample Type: 1. Rat brain cells (100 ug), 2. Rat Brain cells (100 ug) incubatde with HA-UbVME, Band a: unmodified HA-UbVME, Band b: modified UCHL1, Primary dilution: 1:1000, Secondary Antibody: alkaline phosphatase-conjugated anti-rabbit, Secondary dilution: 1:1000.

Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.

Lanes: Lane 1: 75000 rat INS cells, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti rabbit-HRP, Secondary Antibody dilution: 1:1000, Gene Name: UCHL1.

WB Suggested Anti-UCHL1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Muscle.

Quick Database Links

Gene Symbol

UCHL1

UniProt

P09936

RefSeq (Protein):NP_004172