Cart summary

You have no items in your shopping cart.

UCHL1 Rabbit Polyclonal Antibody

SKU: orb331031

Description

Rabbit polyclonal antibody to PGP9.5

Research Area

Cell Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse, Rat
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human UCHL1
TargetUCHL1
Protein SequenceSynthetic peptide located within the following region: ELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALCKAA
Molecular Weight25kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti-Epididymis luminal protein 117 antibody, anti-HEL 117 antibody, anti-HEL S 53 antibody, anti-NDGOA antibody, anti-Neuron cytoplasmic protein 9.5 antibody, anti-Park 5 antibody, anti-PARK5 antibody, anti-PGP 9.5 antibody, anti-PGP9.5 antibody, anti-PGP95 antibody, anti-Protein gene product 9.5 antibody, anti-Ubiquitin C terminal esterase L1 antibody, anti-Ubiquitin C terminal hydrolase antibody, anti-Ubiquitin C terminal hydrolase L1 antibody, anti-Ubiquitin carboxyl terminal esterase L1 antibody, anti-Ubiquitin thioesterase L1 antibody, anti-Ubiquitin thiolesterase antibody, anti-UCH-L1 antibody, anti-UCHL1 antibody, anti-UCHL 1 antibody

Similar Products

  • PGP9.5 Rabbit Polyclonal Antibody [orb6713]

    ELISA,  ICC,  IF,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • PGP9.5 Rabbit Polyclonal Antibody [orb500977]

    IF,  IHC-Fr,  IHC-P

    Bovine, Equine, Guinea pig, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • UCHL1 Antibody (N-term) [orb1931714]

    FC,  IF,  IHC-P,  WB

    Porcine

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    400 μl
  • PGP9.5/UCHL1/PGP9 Rabbit Polyclonal Antibody [orb334572]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • UCH-L1 rabbit pAb Antibody [orb766746]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UCHL1 Rabbit Polyclonal Antibody
UCHL1 Rabbit Polyclonal Antibody
UCHL1 Rabbit Polyclonal Antibody
UCHL1 Rabbit Polyclonal Antibody
UCHL1 Rabbit Polyclonal Antibody

Sample Type: 1. Rat brain cells (100 ug), 2. Rat Brain cells (100 ug) incubatde with HA-UbVME, Band a: unmodified HA-UbVME, Band b: modified UCHL1, Primary dilution: 1:1000, Secondary Antibody: alkaline phosphatase-conjugated anti-rabbit, Secondary dilution: 1:1000.

UCHL1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.

UCHL1 Rabbit Polyclonal Antibody

Lanes: Lane 1: 75000 rat INS cells, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti rabbit-HRP, Secondary Antibody dilution: 1:1000, Gene Name: UCHL1.

UCHL1 Rabbit Polyclonal Antibody

WB Suggested Anti-UCHL1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Muscle.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_004172

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

UCHL1 Rabbit Polyclonal Antibody (orb331031)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry