You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581104 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to UBA3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human UBA3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 52kDa |
Target | UBA3 |
UniProt ID | Q8TBC4 |
Protein Sequence | Synthetic peptide located within the following region: EGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCEL |
NCBI | NP_003959 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | NAE2, UBE1C, hUBA3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: 1. Human NT-2 cells (60 ug), 2. mouse brain extracts (80 ug), Primary antibody dilution: 2 ug/ml, Secondary antibody: IRDye 800CW goat anti-rabbit, Secondary antibody dilution: 1:20000.
Sample Type: Human brain stem cells, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: UBA3: Red DAPI:Blue, Gene Name: UBA3.
WB Suggested Anti-UBA3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Pancreas.
IHC-P, WB | |
Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |
IHC, WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
FITC |