Cart summary

You have no items in your shopping cart.

UBA3 Rabbit Polyclonal Antibody (HRP)

UBA3 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2111642

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2111642
CategoryAntibodies
DescriptionUBA3 Rabbit Polyclonal Antibody (HRP)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityBovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human UBA3
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP
MW52kDa
UniProt IDQ8TBC4
Protein SequenceSynthetic peptide located within the following region: EGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCEL
NCBINP_003959
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Alternative namesNAE2, UBE1C, hUBA3
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.