You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb334996 |
|---|---|
| Category | Antibodies |
| Description | Goat polyclonal antibody to TNF alpha. TNF-α is produced by a variety of immune cells including NK cells, B cells, T cells and macrophages. It is multifunctional proinflammatory cytokine that belongs to the tumour necrosis factor (TNF) superfamily. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is involved in the regulation of several processes including lipid metabolism cell differentiation and proliferation, coagulation and apoptosis. It has been implicated in a variety of diseases, including cancer and autoimmune diseases. |
| Target | Tumor necrosis factor |
| Clonality | Polyclonal |
| Species/Host | Goat |
| Isotype | IgG |
| Conjugation | Unconjugated |
| Reactivity | Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep |
| Concentration | 1 mg/ml |
| Buffer/Preservatives | PBS, 20% glycerol and 0.05% sodium azide |
| Purification | Epitope affinity purified |
| Immunogen | Antigen: Purified recombinant human TNF-_ produced in E. coli.. Antigen Sequence: MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |
| Tested applications | WB |
| Dilution range | WB:1:500-1:2,000 |
| Application notes | The antibody solution should be gently mixed before use. |
| Antibody Type | Primary Antibody |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | APC1, cachectin; tumor necrosis factor ligand supe Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |

Western blot analysis of staining of total protein lysate using TNF alpha antibody
IF, IHC-Fr, IHC-P | |
Mouse, Rat | |
Human | |
Rabbit | |
Recombinant | |
Unconjugated |
FC, ICC | |
Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review