TMEM259 Rabbit Polyclonal Antibody

• Catalog Number: orb55799
• Category: Antibodies
• Description: Rabbit polyclonal antibody to C19ORF6.
• Target: TMEM259
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C19ORF6
• Protein Sequence: Synthetic peptide located within the following region: APGPGPNGGGGGPAPARGPRTPNLNPNPLINVRDRLFHALFFKMAVTYSR
• UniProt ID: Q4ZIN3
• MW: 44 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MBRL, ASBABP1, C19orf6, R32184_3, MEMBRALIN
• Note: For research use only
• NCBI: NP_001028198.1

Sample Tissue: Human THP-1 Whole Cell lysates, Antibody dilution: 1 ug/ml.