C19ORF6 Rabbit Polyclonal Antibody

• Catalog Number: orb324516
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TMEM259
• Target: TMEM259
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C19ORF6
• Protein Sequence: Synthetic peptide located within the following region: YDDILMSSVKGLAENEENKGFLRNVVSGEHYRFVSMWMARTSYLAAFAIM
• UniProt ID: Q4ZIN3
• MW: 46kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti MBRL antibody, anti ASBABP1 antibody, anti R3
• Note: For research use only
• NCBI: NP_219488

Human kidney

WB Suggested Anti-C19ORF6 Antibody Titration: 1.0 ug/mL, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, TMEM259 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.