SLC9A3 Rabbit Polyclonal Antibody

• Catalog Number: orb330345
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC9A3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Mouse, Porcine, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC9A3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 93kDa
• Target: SLC9A3
• UniProt ID: P48764
• Protein Sequence: Synthetic peptide located within the following region: AEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTMRKR
• NCBI: NP_004165
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti MGC126718 antibody, anti MGC126720 antibody,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. A shorter form of this protein also contains the peptide sequence at 91 kDa, and the protein may be phosphorylated and/or glycosylated.

Sample Tissue: Human RPMI-8226, Antibody Dilution: 1.0 ug/mL.

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 3 ug/mL.

WB Suggested Anti-SLC9A3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: COLO205 cell lysate.