You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330345 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SLC9A3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Mouse, Porcine, Rabbit, Rat, Sheep |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SLC9A3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 93kDa |
Target | SLC9A3 |
UniProt ID | P48764 |
Protein Sequence | Synthetic peptide located within the following region: AEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTMRKR |
NCBI | NP_004165 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti MGC126718 antibody, anti MGC126720 antibody, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. A shorter form of this protein also contains the peptide sequence at 91 kDa, and the protein may be phosphorylated and/or glycosylated.
Sample Tissue: Human RPMI-8226, Antibody Dilution: 1.0 ug/mL.
Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 3 ug/mL.
WB Suggested Anti-SLC9A3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: COLO205 cell lysate.