You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
SLC2A6 Rabbit Polyclonal Antibody
Catalog Number: orb325114
| Catalog Number | orb325114 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SLC2A6 |
| Target | SLC2A6 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SLC2A6 |
| Protein Sequence | Synthetic peptide located within the following region: AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLL |
| UniProt ID | Q9UGQ3 |
| MW | 56 kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti GLUT6 antibody, anti GLUT9 antibody, anti HSA Read more... |
| Note | For research use only |
| NCBI | NP_060055 |
Human Muscle
WB Suggested Anti-SLC2A6 Antibody Titration: 2.5 ug/mL, Positive Control: Jurkat cell lysate.
- Item 1 of 4
GLUT6 Rabbit Polyclonal Antibody [orb157189]
IF, IHC-Fr, IHC-P, WB
Human
Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl, 200 μl - Item 1 of 2
