SLC2A6 Rabbit Polyclonal Antibody

• Catalog Number: orb325113
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC2A6
• Target: SLC2A6
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC2A6
• Protein Sequence: Synthetic peptide located within the following region: VFLATFAAVLGNFSFGYALVYTSPVIPALERSLDPDLHLTKSQASWFGSV
• UniProt ID: Q9UGQ3
• MW: 55 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti GLUT6 antibody, anti GLUT9 antibody, anti HSA
• Research Area: Cell Biology
• Note: For research use only
• NCBI: NP_060055

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment.

WB Suggested Anti-SLC2A6 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Liver.