You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
SLC2A6 Rabbit Polyclonal Antibody
Catalog Number: orb325113
| Catalog Number | orb325113 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SLC2A6 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Canine |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLC2A6 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 55 kDa |
| Target | SLC2A6 |
| UniProt ID | Q9UGQ3 |
| Protein Sequence | Synthetic peptide located within the following region: VFLATFAAVLGNFSFGYALVYTSPVIPALERSLDPDLHLTKSQASWFGSV |
| NCBI | NP_060055 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti GLUT6 antibody, anti GLUT9 antibody, anti HSA Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment.
WB Suggested Anti-SLC2A6 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Liver.
- Item 1 of 4
GLUT6 Rabbit Polyclonal Antibody [orb157189]
IF, IHC-Fr, IHC-P, WB
Human
Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl, 200 μl - Item 1 of 2
