Cart summary

You have no items in your shopping cart.

SLC2A6 Rabbit Polyclonal Antibody (FITC)

SLC2A6 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2119929

DispatchUsually dispatched within 5-10 working days
$ 620.00
Catalog Numberorb2119929
CategoryAntibodies
DescriptionSLC2A6 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human SLC2A6
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW56kDa
UniProt IDQ9UGQ3
Protein SequenceSynthetic peptide located within the following region: AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLL
NCBINP_060055
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesGLUT6, GLUT9, HSA011372
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.