You have no items in your shopping cart.
Cart summary
Item 1 of 1
SGO1 Rabbit Polyclonal Antibody
Catalog Number: orb585057
Product Properties
| Catalog Number | orb585057 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SGO1 |
| Target | SGO1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Equine, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human SGOL1 |
| Protein Sequence | Synthetic peptide located within the following region: NSDRPVTRPLAKRALKYTDEKETEGSKPTKTPTTTPPETQQSPHLSLKDI |
| UniProt ID | B5BUA4 |
| MW | 60kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | SGO, CAID, SGOL1, NY-BR-85 |
| Note | For research use only |
| NCBI | NP_001012409 |
Images
WB Suggested Anti-SGOL1 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Thymus.
Similar Products
- Item 1 of 3
- Item 1 of 1
Sgo1 (phospho Ser14) rabbit pAb [orb767784]
ELISA, IHC-P
Human, Mouse, Rat
Polyclonal
Unconjugated
50 μl, 100 μl - Item 1 of 1
- Item 1 of 1
- Item 1 of 1
Reviews
SGO1 Rabbit Polyclonal Antibody (orb585057)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review