SARS-CoV-2 (COVID-19) RBD Recombinant Protein

• Catalog Number: orb1231620
• Category: Proteins
• Description: SARS-CoV-2 (COVID-19) RBD Recombinant Protein
• Tested applications: ELISA
• Concentration: 0.5 mg/ml
• Dilution range: ELISA
• Form/Appearance: Liquid
• Purity: > 95% by SDS Page
• MW: The predicted molecular mass is ~33 kDa.
• Protein Sequence: RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFK CYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWN SNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGF QPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESN KKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCS
• Source: HEK293 cells
• NCBI: QHD43416.1
• Storage: This recombinant protein may be stored as received at 2-8°C for up to one month. For longer term storage, aseptically aliquot in working volumes without diluting and store at -80°C. Avoid Repeated Freeze Thaw Cycles.
• Buffer/Preservatives: This recombinant protein is aseptically packaged and formulated in 0.01 M phosphate buffered saline (PBS) pH 7.2 - 7.4, 150 mM NaCl with no carrier protein, potassium, calcium or preservatives added.
• Note: For research use only
• Application notes: ELISA
• Expiration Date: 6 months from date of receipt.

Purified SARS-CoV-2 Receptor Binding Domain (RBD) Spike Protein under non-reducing conditions. Lane 1-RBD Protein loaded at 10 μg. Lane 2-RBD Protein loaded 20 μg