You have no items in your shopping cart.
Cart summary
Item 1 of 1
SARS-CoV-2 (COVID-19) RBD Recombinant Protein
Catalog Number: orb1231620
| Catalog Number | orb1231620 |
|---|---|
| Category | Proteins |
| Description | SARS-CoV-2 (COVID-19) RBD Recombinant Protein |
| Form/Appearance | Liquid |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | This recombinant protein is aseptically packaged and formulated in 0.01 M phosphate buffered saline (PBS) pH 7.2 - 7.4, 150 mM NaCl with no carrier protein, potassium, calcium or preservatives added. |
| Purity | > 95% by SDS Page |
| Protein Sequence | RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFK CYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWN SNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGF QPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESN KKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCS |
| MW | The predicted molecular mass is ~33 kDa. |
| Tested applications | ELISA |
| Application notes | ELISA |
| Source | HEK293 cells |
| Storage | This recombinant protein may be stored as received at 2-8˚°C for up to one month. For longer term storage, aseptically aliquot in working volumes without diluting and store at -80˚°C. Avoid Repeated Freeze Thaw Cycles. |
| Dry Ice Shipping | Please note: This product requires shipment on dry ice. A dry ice surcharge will apply. |
| Note | For research use only |
| NCBI | QHD43416.1 |
Purified SARS-CoV-2 Receptor Binding Domain (RBD) Spike Protein under non-reducing conditions. Lane 1-RBD Protein loaded at 10 μg. Lane 2-RBD Protein loaded 20 μg
- Item 1 of 6
SARS-CoV-2 (COVID-19) Delta Variant Spike S1 (His-Avi Tag) Recombinant Protein [orb1228206]
ELISA, SDS-PAGE, WB
> 90% as determined by Bis-Tris PAGE
120 kD
HEK293 cells
0.05 mg - Item 1 of 6
SARS-CoV-2 (COVID-19) Delta Variant Spike RBD (His-Avi Tag) Recombinant Protein [orb1228207]
ELISA, SDS-PAGE, WB
> 95% as determined by Bis-Tris PAGE
35 kD
HEK293 cells
0.05 mg - Item 1 of 4
Recombinant SARS-Cov-2 Spike RBD protein, mFc (HEK293) [orb1516638]
> 90% as determined by SDS-PAGE
60 kDa
100 μg, 500 μg - Item 1 of 4
Recombinant SARS-Cov-2 Spike RBD protein (E417N, E484K, N501Y), His [orb1516703]
> 90% as determined by SDS-PAGE
36 kDa
500 μg, 100 μg - Item 1 of 4
SARS-CoV-2 (COVID-19) UK variant (B.1.1.7) S RBD (N501Y) Recombinant Protein [orb1231548]
ELISA, WB
> 95% as determined by Bis-Tris PAGE; > 95% as determined by HPLCEndotoxin level is less than 1EU per ug by the LAL method.
HEK293 cells
0.1 mg
