S100A8 Rabbit Polyclonal Antibody

SKU: orb585002

Description

S100A8 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting S100A8. It is suitable for IHC, WB and is reactive with human samples. Predicted reactivity includes Human. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: S100A8
• Protein Sequence: Synthetic peptide located within the following region: QYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
• Molecular Weight: 10kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

P8, MIF, NIF, CAGA, CFAG, CGLA, L1Ag, MRP8, CP-10, MA387, 60B8AG

Quick Database Links

Gene Symbol

S100A8

UniProt

P05109

RefSeq (Protein):NP_002955