Cart summary

You have no items in your shopping cart.

Prkaa1 Rabbit Polyclonal Antibody

SKU: orb582167

Description

Rabbit polyclonal antibody to Prkaa1

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse, Rat
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Sheep, Yeast, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
TargetPrkaa1
Protein SequenceSynthetic peptide located within the following region: STPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRH
Molecular Weight60kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

AMPK, AI194361, AI450832, AL024255, AMPKalpha1, C130083N04Rik

Similar Products

  • Phospho-AMPK alpha-1 (Thr183) Rabbit Polyclonal Antibody [orb4412]

    FC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-AMPK alpha 1 (Ser356) Rabbit Polyclonal Antibody [orb506148]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Porcine, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • AMPK alpha 1 Rabbit Polyclonal Antibody [orb10076]

    FC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-AMPK alpha 1 (Thr183) + AMPK alpha 2 (Thr172) Rabbit Polyclonal Antibody [orb182418]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
  • AMPKα1/2 Polyclonal Antibody [orb1414692]

    IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Prkaa1 Rabbit Polyclonal Antibody

Sample Type: rat hepatocyte (50 ug), Primary dilution: 1:1000, Secondary Antibody: Donkey anti-Rabbit HRP, Secondary dilution: 1:10000.

Prkaa1 Rabbit Polyclonal Antibody

Prkaa1 antibody - N-terminal region (orb582167) validated by WB using mouse liver at 1:1000.

Prkaa1 Rabbit Polyclonal Antibody

Rabbit Anti-PRKAA1 Antibody, Catalog Number: orb582167, Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Prkaa1 Rabbit Polyclonal Antibody (orb582167)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry