Pgr Rabbit Polyclonal Antibody

SKU: orb576158

Description

Pgr Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Pgr. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of mouse Pgr. This antibody reacts with Mouse samples and is predicted to react with Canine, Guinea pig, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Canine, Guinea pig, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse Pgr
• Target: Pgr
• Protein Sequence: Synthetic peptide located within the following region: SGSAHWPGAGVKPSPQPAAGEVEEDSGLETEGSAAPLLKSKPRALEGTGS
• Molecular Weight: 99
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

P, PR, NR3, PR-A, PR-B, NR3C3, BB114106, 9930019P03Rik

Quick Database Links

Gene Symbol

Pgr

UniProt

A6H6A5

RefSeq (Protein):NP_032855