You have no items in your shopping cart.
Description
Research Area
Metabolism Research
Images & Validation
−
Key Properties
−| CAS Number | 62340-29-8 |
|---|---|
| MW | 4421.86 Da |
| Purity | > 95% by HPLC |
| Formula | C192H295N59O60S |
| Protein Sequence | H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala-OH |
Storage & Handling
−| Storage | Store dry, dark and frozen |
|---|---|
| Form/Appearance | Freeze dried solid |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−feeding, 62340-29-8GH070, GLP-1), Glucagon 37, HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA, OXM, Oxyntomodulin , anorectic, endogenous, glucagon-like peptide, metabolism
Similar Products
−- Item 1 of 6
Glucagon Antibody (C-term) [orb1929798]
FC, IF, IHC-P, WB
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl - Item 1 of 7
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Oxyntomodulin (orb1147065)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days