NSP12 (SARS-CoV-2) Antibody

• Catalog Number: orb1463306
• Category: Antibodies
• Description: Nsp12 is part of the multifunctional protein replicase polyprotein 1ab that is involved in the transcription and replication of viral RNA. This non-structural, RNA-directed RNA polymerase is responsible for replication and transcription of the viral RNA genome.
• Target: NSP12 (SARS-CoV-2)
• Clonality: Polyclonal
• Species/Host: Goat
• Isotype: IgG
• Conjugation: Unconjugated
• Reactivity: Virus
• Concentration: 1 mg/ml
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Purification: Epitope affinity purified
• Immunogen: Antigen: Affinity purified recombinant fusion protein using the C-terminal of Nsp12 (residues 820 to stop) and produced in E. coli.. Antigen Sequence: MPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEF YEAMYTPHTVLQ
• Tested applications: WB
• Dilution range: WB:1:500-1:2,000
• Application notes: The antibody solution should be gently mixed before use.
• Antibody Type: Primary Antibody
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Nsp12 SARS Coronavirus-2, RNA-directed RNA polymer
• Note: For research use only
• Expiration Date: 12 months from date of receipt.