You have no items in your shopping cart.
You have no items in your shopping cart.

| Catalog Number | orb1463319 |
|---|---|
| Category | Antibodies |
| Description | Nsp12 is part of the multifunctional protein replicase polyprotein 1ab that is involved in the transcription and replication of viral RNA. This non-structural, RNA-directed RNA polymerase is responsible for replication and transcription of the viral RNA genome. |
| Target | NSP12 (SARS-CoV-2) |
| Clonality | Polyclonal |
| Species/Host | Goat |
| Isotype | IgG |
| Conjugation | Unconjugated |
| Reactivity | Virus |
| Concentration | 1 mg/ml |
| Buffer/Preservatives | PBS, 20% glycerol and 0.05% sodium azide |
| Purification | Epitope affinity purified |
| Immunogen | Antigen: Affinity purified recombinant fusion protein using the C-terminal of Nsp12 (residues 820 to stop) and produced in E. coli.. Antigen Sequence: MPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQ |
| Tested applications | WB |
| Dilution range | WB:1:500-1:2,000 |
| Application notes | The antibody solution should be gently mixed before use. |
| Antibody Type | Primary Antibody |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | Nsp12 SARS Coronavirus-2, RNA-directed RNA polymer Read more... |
| Note | For research use only |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review