NES Rabbit Polyclonal Antibody

SKU: orb330997

Description

Rabbit polyclonal antibody to NES

Research Area

Epigenetics & Chromatin, Molecular Biology, Neuroscience, Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Porcine

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NES
• Target: NES
• Protein Sequence: Synthetic peptide located within the following region: LPDSTPLGFYLRSPTSPRWDPTGEQRPPPQGETGKEGWDPAVLASEGLEA
• Molecular Weight: 177kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti FLJ21841 antibody, anti Nbla00170 antibody

Heart

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody dilution: 1 ug/ml.

WB Suggested Anti-NES Antibody, Positive Control: Lane 1: 25 ug mouse NIH3T3 lysate, Lane 2: 25 ug mouse embryonic stem cell lysate, Lane 3: 25 ug mouse neural stem cell lysate, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:3000.

WB Suggested Anti-NES Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: OVCAR-3 cell lysate.

Quick Database Links

Gene Symbol

NES

UniProt

P48681

RefSeq (Protein):NP_006608