Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Mouse IL-10 protein

SKU: orb1216249

Description

The Mouse IL-10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse IL-10 applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse IL-10 yeast-derived recombinant protein can be purchased in multiple sizes. Mouse IL-10 Specifications: (Molecular Weight: 18.8 kDa) (Amino Acid Sequence: SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS (160)) (Gene ID: 16153).

Research Area

Immunology & Inflammation

Images & Validation

Key Properties

SourceYeast
Biological OriginMouse
TargetIL-10
Protein Length170.0
MW18.8 kDa
Purity98%
Protein SequenceSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS (170)

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • Mouse Il10 protein [orb594838]

    Greater than 95% as determined by SDS-PAGE.

    18.9 kDa

    E.coli

    50 μg, 10 μg, 1 mg, 500 μg
  • Mouse IL10 protein (Active) [orb359015]

    > 97% as determined by SDS-PAGE and HPLC.

    18.7 kDa

    E.Coli

    500 μg, 100 μg, 10 μg
  • Recombinant Mouse IL-22 Protein [orb2994339]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.

    Predicted: 43.8 KDa. Observed: 50-65 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • Recombinant Mouse IL-22 Protein [orb2995243]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (Regularly tested)

    Predicted: 16.7 KDa. Observed: 15 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • Mouse IL-10 Protein, His Tag [orb334904]

    Unconjugated

    92%

    19.6 kDa

    50 μg, 20 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Mouse IL-10 protein (orb1216249)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 300.00
25 μg
$ 540.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry